SCOPe 2.08: Domain d5olnb1: 5oln B:1-70

Lineage for d5olnb1 (5oln B:1-70)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.0: automated matches [254276] (1 protein)
   not a true family

6. Protein automated matches [254641] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [326391] (2 PDB entries)

8. Domain d5olnb1: 5oln B:1-70 [351258]
   Other proteins in same PDB: d5olna2, d5olna3, d5olnb2, d5olnb3, d5olnb4
   automated match to d5ep8a1
   complexed with edo, imd, so4

Details for d5olnb1

PDB Entry: 5oln, 1.88 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis at 1.88 a

PDB Compounds: (B:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5olnb1:

Sequence; same for both SEQRES and ATOM records:

>d5olnb1 a.46.2.0 (B:1-70) automated matches {Bacillus subtilis [TaxId: 224308]}
mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffqdmsdreradltm
amvnsgetid

Timeline for d5olnb1:

• d5olnb1 first appeared in SCOPe 2.07