Lineage for d5olna1 (5oln A:1-70)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327502Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2327513Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2327573Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 2327574Protein automated matches [254641] (5 species)
    not a true protein
  7. 2327575Species Bacillus subtilis [TaxId:224308] [326391] (2 PDB entries)
  8. 2327576Domain d5olna1: 5oln A:1-70 [351259]
    Other proteins in same PDB: d5olna2, d5olna3, d5olnb2, d5olnb3, d5olnb4
    automated match to d5ep8a1
    complexed with edo, imd, so4

Details for d5olna1

PDB Entry: 5oln (more details), 1.88 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis at 1.88 a
PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5olna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5olna1 a.46.2.0 (A:1-70) automated matches {Bacillus subtilis [TaxId: 224308]}
mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffqdmsdreradltm
amvnsgetid

SCOPe Domain Coordinates for d5olna1:

Click to download the PDB-style file with coordinates for d5olna1.
(The format of our PDB-style files is described here.)

Timeline for d5olna1: