Lineage for d8icd__ (8icd -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27255Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 27256Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 27257Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 27297Protein Isocitrate dehydrogenase, ICDH [53668] (1 species)
  7. 27298Species Escherichia coli [TaxId:562] [53669] (23 PDB entries)
  8. 27309Domain d8icd__: 8icd - [35076]

Details for d8icd__

PDB Entry: 8icd (more details), 2.5 Å

PDB Description: regulation of an enzyme by phosphorylation at the active site

SCOP Domain Sequences for d8icd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d8icd__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirelnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOP Domain Coordinates for d8icd__:

Click to download the PDB-style file with coordinates for d8icd__.
(The format of our PDB-style files is described here.)

Timeline for d8icd__: