Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein Isocitrate dehydrogenase, ICDH [53668] (2 species) |
Species Escherichia coli [TaxId:562] [53669] (27 PDB entries) |
Domain d8icda_: 8icd A: [35076] complexed with ict, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 8icd (more details), 2.5 Å
SCOPe Domain Sequences for d8icda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d8icda_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirelnvalrqel dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
Timeline for d8icda_: