Lineage for d1ai3__ (1ai3 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily) Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) 
Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins) 
Protein Isocitrate dehydrogenase, ICDH [53668] (1 species) Species Escherichia coli [TaxId:562] [53669] (23 PDB entries) 
Domain d1ai3__: 1ai3 - [35066]
Details for d1ai3__
PDB Entry: 1ai3 (more details), 1.9 Å
PDB Description: orbital steering in the catalytic power of enzymes: small structural changes with large catalytic consequences
SCOP Domain Sequences for d1ai3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ai3__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
SCOP Domain Coordinates for d1ai3__:
Click to download the PDB-style file with coordinates for d1ai3__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ai3__:
- d1ai3__ appears in SCOP 1.57
- d1ai3__ appears in the current release, SCOPe 2.08, called d1ai3a_
View in 3D