![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
![]() | Protein Isocitrate dehydrogenase, ICDH [53668] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53669] (27 PDB entries) |
![]() | Domain d1ai3a_: 1ai3 A: [35066] complexed with ict, mg, ndo has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ai3 (more details), 1.9 Å
SCOPe Domain Sequences for d1ai3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ai3a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
Timeline for d1ai3a_: