Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species) |
Species Salmonella typhimurium [TaxId:90371] [53666] (1 PDB entry) |
Domain d1cnzb_: 1cnz B: [35062] complexed with mn, so4 |
PDB Entry: 1cnz (more details), 1.76 Å
SCOPe Domain Sequences for d1cnzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnzb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva egv
Timeline for d1cnzb_: