Lineage for d1cnzb_ (1cnz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905794Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)
  7. 2905818Species Salmonella typhimurium [TaxId:90371] [53666] (1 PDB entry)
  8. 2905820Domain d1cnzb_: 1cnz B: [35062]
    complexed with mn, so4

Details for d1cnzb_

PDB Entry: 1cnz (more details), 1.76 Å

PDB Description: 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium
PDB Compounds: (B:) protein (3-isopropylmalate dehydrogenase)

SCOPe Domain Sequences for d1cnzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnzb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]}
msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka
tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf
cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf
dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva
egv

SCOPe Domain Coordinates for d1cnzb_:

Click to download the PDB-style file with coordinates for d1cnzb_.
(The format of our PDB-style files is described here.)

Timeline for d1cnzb_: