PDB entry 1cnz

View 1cnz on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, leucine biosynthetic pathway, nad-dependant enzyme
Deposited on 1999-05-24, released 1999-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (3-isopropylmalate dehydrogenase)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: LEU B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cnza_
  • Chain 'B':
    Compound: protein (3-isopropylmalate dehydrogenase)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: LEU B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cnzb_
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnzA (A:)
    msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka
    tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf
    cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
    esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf
    dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
    qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva
    egv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnzB (B:)
    msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka
    tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf
    cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
    esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf
    dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
    qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva
    egv