Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins) the active site is between the two identical subunits |
Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (7 species) |
Species Chimera (Thermus thermophilus) and (Bacillus subtilis) [TaxId:274] [53663] (2 PDB entries) |
Domain d1xac__: 1xac - [35056] |
PDB Entry: 1xac (more details), 2.1 Å
SCOP Domain Sequences for d1xac__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xac__ c.77.1.1 (-) 3-isopropylmalate dehydrogenase, IPMDH {Chimera (Thermus thermophilus) and (Bacillus subtilis)} mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg veeaeavllgsvggpkwdqnprelrpekgllsirkqldlfanlrpvkvfeslsdasplkk eyidnvdfvivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh afglvelarkvedavakalletpppdlggsagteaftatvlrhla
Timeline for d1xac__: