SCOP 1.69: Domain d1xac__: 1xac -

Lineage for d1xac__ (1xac -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (7 species)

7. Species Chimera (Thermus thermophilus) and (Bacillus subtilis) [TaxId:274] [53663] (2 PDB entries)

8. Domain d1xac__: 1xac - [35056]

Details for d1xac__

PDB Entry: 1xac, 2.1 Å

PDB Description: chimera isopropylmalate dehydrogenase between bacillus subtilis (m) and thermus thermophilus (t) from n-terminal: 20% t middle 20% m residual 60% t, mutated at s82r. low temperature (100k) structure.

SCOP Domain Sequences for d1xac__:

Sequence; same for both SEQRES and ATOM records:

>d1xac__ c.77.1.1 (-) 3-isopropylmalate dehydrogenase, IPMDH {Chimera (Thermus thermophilus) and (Bacillus subtilis)}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdqnprelrpekgllsirkqldlfanlrpvkvfeslsdasplkk
eyidnvdfvivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

Timeline for d1xac__:

• d1xac__ first appeared (with stable ids) in SCOP 1.55
  
• d1xac__ appears in SCOP 1.67
  
• d1xac__ appears in SCOP 1.71
  
• d1xac__ appears in the current release, SCOPe 2.08, called d1xaca_