Lineage for d1dr0a_ (1dr0 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27255Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 27256Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 27257Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 27258Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)
  7. 27271Species Thermus thermophilus [TaxId:274] [53662] (14 PDB entries)
  8. 27284Domain d1dr0a_: 1dr0 A: [35045]

Details for d1dr0a_

PDB Entry: 1dr0 (more details), 2.2 Å

PDB Description: structure of modified 3-isopropylmalate dehydrogenase at the c- terminus, hd708

SCOP Domain Sequences for d1dr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr0a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvtatvgi

SCOP Domain Coordinates for d1dr0a_:

Click to download the PDB-style file with coordinates for d1dr0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dr0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dr0b_