PDB entry 1dr0

View 1dr0 on RCSB PDB site
Description: structure of modified 3-isopropylmalate dehydrogenase at the c- terminus, hd708
Deposited on 2000-01-06, released 2000-01-19
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.249
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dr0a_
  • Chain 'B':
    Domains in SCOP 1.55: d1dr0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dr0A (A:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvtatvgi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dr0B (B:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvtatvgi