SCOPe 2.08: Domain d6bmhe1: 6bmh E:7-185

Lineage for d6bmhe1 (6bmh E:7-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6bmhe1: 6bmh E:7-185 [349714]
   Other proteins in same PDB: d6bmha2, d6bmhb_, d6bmhc2, d6bmhd_, d6bmhe2, d6bmhf_, d6bmhg2, d6bmhh_
   automated match to d1zt4c2
   complexed with f61, nag

Details for d6bmhe1

PDB Entry: 6bmh, 2.3 Å

PDB Description: crystal structure of mhc-i like protein

PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d2

SCOPe Domain Sequences for d6bmhe1:

Sequence; same for both SEQRES and ATOM records:

>d6bmhe1 d.19.1.0 (E:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqtssfaniswsrtdslillgdlqthrwsndsaiisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlstgcemypgnasesffhvafqgkyav
rfrgtswqrvlgapswldlpikvlnadqgtsatvqtllndtwpqfarglleagksdlek

Timeline for d6bmhe1:

• d6bmhe1 first appeared in SCOPe 2.07