![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
![]() | Domain d6bmha1: 6bmh A:7-185 [349671] Other proteins in same PDB: d6bmha2, d6bmhb_, d6bmhc2, d6bmhd_, d6bmhe2, d6bmhf_, d6bmhg2, d6bmhh_ automated match to d1zt4c2 complexed with f61, nag |
PDB Entry: 6bmh (more details), 2.3 Å
SCOPe Domain Sequences for d6bmha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bmha1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqtssfaniswsrtdslillgdlqthrwsndsaiisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlstgcemypgnasesffhvafqgkyav rfrgtswqrvlgapswldlpikvlnadqgtsatvqtllndtwpqfarglleagksdlek
Timeline for d6bmha1: