![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d6bmhe2: 6bmh E:186-279 [349715] Other proteins in same PDB: d6bmha1, d6bmhb_, d6bmhc1, d6bmhd_, d6bmhe1, d6bmhf_, d6bmhg1, d6bmhh_ automated match to d1zt4c1 complexed with f61, nag |
PDB Entry: 6bmh (more details), 2.3 Å
SCOPe Domain Sequences for d6bmhe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bmhe2 b.1.1.0 (E:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghlqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d6bmhe2: