Lineage for d6bmhe2 (6bmh E:186-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760141Domain d6bmhe2: 6bmh E:186-279 [349715]
    Other proteins in same PDB: d6bmha1, d6bmhb_, d6bmhc1, d6bmhd_, d6bmhe1, d6bmhf_, d6bmhg1, d6bmhh_
    automated match to d1zt4c1
    complexed with f61, nag

Details for d6bmhe2

PDB Entry: 6bmh (more details), 2.3 Å

PDB Description: crystal structure of mhc-i like protein
PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d2

SCOPe Domain Sequences for d6bmhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bmhe2 b.1.1.0 (E:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghlqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d6bmhe2:

Click to download the PDB-style file with coordinates for d6bmhe2.
(The format of our PDB-style files is described here.)

Timeline for d6bmhe2: