SCOPe 2.08: Domain d6bmha2: 6bmh A:186-279

Lineage for d6bmha2 (6bmh A:186-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6bmha2: 6bmh A:186-279 [349672]
   Other proteins in same PDB: d6bmha1, d6bmhb_, d6bmhc1, d6bmhd_, d6bmhe1, d6bmhf_, d6bmhg1, d6bmhh_
   automated match to d1zt4c1
   complexed with f61, nag

Details for d6bmha2

PDB Entry: 6bmh, 2.3 Å

PDB Description: crystal structure of mhc-i like protein

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d2

SCOPe Domain Sequences for d6bmha2:

Sequence; same for both SEQRES and ATOM records:

>d6bmha2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghlqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Timeline for d6bmha2:

• d6bmha2 first appeared in SCOPe 2.07