Lineage for d6aupi1 (6aup I:1-36)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030705Protein automated matches [197331] (11 species)
    not a true protein
  7. 3030717Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries)
  8. 3030730Domain d6aupi1: 6aup I:1-36 [349306]
    Other proteins in same PDB: d6aupa2, d6aupb2, d6aupc2, d6aupd2, d6aupe2, d6aupf2, d6aupg2, d6auph2, d6aupi2, d6aupj2, d6aupk2, d6aupl2, d6aupm2, d6aupn2, d6aupo2, d6aupp2
    automated match to d1j5ja_
    complexed with gol, so4

Details for d6aupi1

PDB Entry: 6aup (more details), 1.95 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox
PDB Compounds: (I:) Potassium channel toxin gamma-KTx 2.2

SCOPe Domain Sequences for d6aupi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aupi1 g.3.7.2 (I:1-36) automated matches {Mesobuthus martensii [TaxId: 34649]}
rptdikcsasyqcfpvcksrfgktngrcvnglcdcf

SCOPe Domain Coordinates for d6aupi1:

Click to download the PDB-style file with coordinates for d6aupi1.
(The format of our PDB-style files is described here.)

Timeline for d6aupi1: