| Class g: Small proteins [56992] (100 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
| Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
| Protein automated matches [197331] (11 species) not a true protein |
| Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries) |
| Domain d6aupe1: 6aup E:1-36 [349180] Other proteins in same PDB: d6aupa2, d6aupb2, d6aupc2, d6aupd2, d6aupe2, d6aupf2, d6aupg2, d6auph2, d6aupi2, d6aupj2, d6aupk2, d6aupl2, d6aupm2, d6aupn2, d6aupo2, d6aupp2 automated match to d1j5ja_ complexed with gol, so4 |
PDB Entry: 6aup (more details), 1.95 Å
SCOPe Domain Sequences for d6aupe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aupe1 g.3.7.2 (E:1-36) automated matches {Mesobuthus martensii [TaxId: 34649]}
rptdikcsasyqcfpvcksrfgktngrcvnglcdcf
Timeline for d6aupe1:
View in 3DDomains from other chains: (mouse over for more information) d6aupa1, d6aupa2, d6aupb1, d6aupb2, d6aupc1, d6aupc2, d6aupd1, d6aupd2, d6aupf1, d6aupf2, d6aupg1, d6aupg2, d6auph1, d6auph2, d6aupi1, d6aupi2, d6aupj1, d6aupj2, d6aupk1, d6aupk2, d6aupl1, d6aupl2, d6aupm1, d6aupm2, d6aupn1, d6aupn2, d6aupo1, d6aupo2, d6aupp1, d6aupp2 |