PDB entry 6aup
View 6aup on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on
2017-09-01, released
2018-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-03-14, with a file datestamp of
2018-03-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupa1, d6aupa2 - Chain 'B':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupb1, d6aupb2 - Chain 'C':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupc1, d6aupc2 - Chain 'D':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupd1, d6aupd2 - Chain 'E':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupe1, d6aupe2 - Chain 'F':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupf1, d6aupf2 - Chain 'G':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupg1, d6aupg2 - Chain 'H':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6auph1, d6auph2 - Chain 'I':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupi1, d6aupi2 - Chain 'J':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupj1, d6aupj2 - Chain 'K':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupk1, d6aupk2 - Chain 'L':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupl1, d6aupl2 - Chain 'M':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupm1, d6aupm2 - Chain 'N':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupn1, d6aupn2 - Chain 'O':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupo1, d6aupo2 - Chain 'P':
Compound: Potassium channel toxin gamma-KTx 2.2
Species: Mesobuthus martensii [TaxId:34649]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6aupp1, d6aupp2 - Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupA (A:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupB (B:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupC (C:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupD (D:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupE (E:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupF (F:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupG (G:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupH (H:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupI (I:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'J':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupJ (J:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'K':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupK (K:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupL (L:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'M':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupM (M:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'N':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupN (N:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'O':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupO (O:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf
- Chain 'P':
Sequence; same for both SEQRES and ATOM records: (download)
>6aupP (P:)
gsrptdikcsasyqcfpvcksrfgktngrcvnglcdcf