SCOPe 2.08: Domain d1d1gb_: 1d1g B:

Lineage for d1d1gb_ (1d1g B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Thermotoga maritima [TaxId:2336] [53603] (2 PDB entries)

8. Domain d1d1gb_: 1d1g B: [34890]
   complexed with mtx, ndp

Details for d1d1gb_

PDB Entry: 1d1g, 2.1 Å

PDB Description: dihydrofolate reductase from thermotoga maritima

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1d1gb_:

Sequence; same for both SEQRES and ATOM records:

>d1d1gb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]}
akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve

Timeline for d1d1gb_:

• d1d1gb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d1gb_ appears in SCOPe 2.07