Lineage for d1d1gb_ (1d1g B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903517Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. 2903752Species Thermotoga maritima [TaxId:2336] [53603] (2 PDB entries)
  8. 2903756Domain d1d1gb_: 1d1g B: [34890]
    complexed with mtx, ndp

Details for d1d1gb_

PDB Entry: 1d1g (more details), 2.1 Å

PDB Description: dihydrofolate reductase from thermotoga maritima
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1d1gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1gb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]}
akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve

SCOPe Domain Coordinates for d1d1gb_:

Click to download the PDB-style file with coordinates for d1d1gb_.
(The format of our PDB-style files is described here.)

Timeline for d1d1gb_: