Lineage for d1d1gb_ (1d1g B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26980Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 26981Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 26982Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 26986Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 27062Species Thermotoga maritima [TaxId:243274] [53603] (2 PDB entries)
  8. 27064Domain d1d1gb_: 1d1g B: [34890]

Details for d1d1gb_

PDB Entry: 1d1g (more details), 2.1 Å

PDB Description: dihydrofolate reductase from thermotoga maritima

SCOP Domain Sequences for d1d1gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1gb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima}
akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve

SCOP Domain Coordinates for d1d1gb_:

Click to download the PDB-style file with coordinates for d1d1gb_.
(The format of our PDB-style files is described here.)

Timeline for d1d1gb_: