PDB entry 1d1g

View 1d1g on RCSB PDB site
Description: dihydrofolate reductase from thermotoga maritima
Class: oxidoreductase
Keywords: dimer, hyperthermophile, oxidoreductase
Deposited on 1999-09-16, released 2000-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1ga_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1gb_
  • Heterogens: NDP, MTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d1gA (A:)
    akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
    vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
    tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysvekshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1gA (A:)
    akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
    vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
    tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d1gB (B:)
    akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
    vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
    tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysvekshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1gB (B:)
    akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
    vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
    tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve