SCOPe 2.08: Domain d5w58a1: 5w58 A:33-73

Lineage for d5w58a1 (5w58 A:33-73)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)

8. Domain d5w58a1: 5w58 A:33-73 [348122]
   Other proteins in same PDB: d5w58a2
   automated match to d3ntga1
   complexed with bog, ff8, hem, nag

Details for d5w58a1

PDB Entry: 5w58, 2.27 Å

PDB Description: crystal complex of cyclooxygenase-2: (s)-arn-2508 (a dual cox and faah inhibitor)

PDB Compounds: (A:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d5w58a1:

Sequence; same for both SEQRES and ATOM records:

>d5w58a1 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d5w58a1:

• d5w58a1 first appeared in SCOPe 2.07