| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
| Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries) |
| Domain d5w58a1: 5w58 A:33-73 [348122] Other proteins in same PDB: d5w58a2 automated match to d3ntga1 complexed with bog, ff8, hem, nag |
PDB Entry: 5w58 (more details), 2.27 Å
SCOPe Domain Sequences for d5w58a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w58a1 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d5w58a1: