Lineage for d5w9ga1 (5w9g A:1-195)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882703Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2882707Protein PA N-terminal domain [254375] (8 species)
  7. 2882737Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. 2882792Domain d5w9ga1: 5w9g A:1-195 [348062]
    Other proteins in same PDB: d5w9ga2
    automated match to d4e5ed_
    complexed with cl, ku2, mn, so4

Details for d5w9ga1

PDB Entry: 5w9g (more details), 2.1 Å

PDB Description: crystal structure of the influenza virus pa endonuclease in complex with inhibitor 9k (sri-30023)
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5w9ga1:

Sequence, based on SEQRES records: (download)

>d5w9ga1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse

Sequence, based on observed residues (ATOM records): (download)

>d5w9ga1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
kthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse

SCOPe Domain Coordinates for d5w9ga1:

Click to download the PDB-style file with coordinates for d5w9ga1.
(The format of our PDB-style files is described here.)

Timeline for d5w9ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w9ga2