Lineage for d1ehyd_ (1ehy D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26774Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)
  6. 26775Protein Bacterial epoxide hydrolase [53528] (2 species)
  7. 26776Species Agrobacterium radiobacter [TaxId:358] [53529] (1 PDB entry)
  8. 26780Domain d1ehyd_: 1ehy D: [34696]

Details for d1ehyd_

PDB Entry: 1ehy (more details), 2.1 Å

PDB Description: X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
PDB Compounds: (D:)

SCOP Domain Sequences for d1ehyd_:

Sequence, based on SEQRES records: (download)

>d1ehyd_ c.69.1.11 (D:) Bacterial epoxide hydrolase {Agrobacterium radiobacter}
airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
drvikaaifdpiqpdfgpvyfglghvheswysqfhqldmavevvgssrevckkyfkhffd
hwsyrdellteeelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmi
wglgdtcvpyapliefvpkyysnytmetiedcghflmvekpeiaidriktafr

Sequence, based on observed residues (ATOM records): (download)

>d1ehyd_ c.69.1.11 (D:) Bacterial epoxide hydrolase {Agrobacterium radiobacter}
airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
drvikaaifdpiqpdfeswysqfhqldmavevvgssrevckkyfkhffdhwsyrdellte
eelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiwglgdtcvpya
pliefvpkyysnytmetiedcghflmvekpeiaidriktafr

SCOP Domain Coordinates for d1ehyd_:

Click to download the PDB-style file with coordinates for d1ehyd_.
(The format of our PDB-style files is described here.)

Timeline for d1ehyd_: