Lineage for d1ehyd1 (1ehy D:3-294)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134816Family c.69.1.11: Epoxide hydrolase [53525] (3 protein domains)
  6. 2134817Protein Bacterial epoxide hydrolase [53528] (2 species)
  7. 2134818Species Agrobacterium radiobacter [TaxId:358] [53529] (1 PDB entry)
  8. 2134822Domain d1ehyd1: 1ehy D:3-294 [34696]
    Other proteins in same PDB: d1ehya2, d1ehyb2, d1ehyc2, d1ehyd2
    complexed with k

Details for d1ehyd1

PDB Entry: 1ehy (more details), 2.1 Å

PDB Description: X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
PDB Compounds: (D:) protein (soluble epoxide hydrolase)

SCOPe Domain Sequences for d1ehyd1:

Sequence, based on SEQRES records: (download)

>d1ehyd1 c.69.1.11 (D:3-294) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}
irrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivpd
lrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkysd
rvikaaifdpiqpdfgpvyfglghvheswysqfhqldmavevvgssrevckkyfkhffdh
wsyrdellteeelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiw
glgdtcvpyapliefvpkyysnytmetiedcghflmvekpeiaidriktafr

Sequence, based on observed residues (ATOM records): (download)

>d1ehyd1 c.69.1.11 (D:3-294) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}
irrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivpd
lrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkysd
rvikaaifdpiqpdfeswysqfhqldmavevvgssrevckkyfkhffdhwsyrdelltee
elevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiwglgdtcvpyap
liefvpkyysnytmetiedcghflmvekpeiaidriktafr

SCOPe Domain Coordinates for d1ehyd1:

Click to download the PDB-style file with coordinates for d1ehyd1.
(The format of our PDB-style files is described here.)

Timeline for d1ehyd1: