Lineage for d1fwya2 (1fwy A:3-251)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (8 families) (S)
  5. 26543Family c.68.1.5: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53461] (1 protein)
  6. 26544Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (1 species)
  7. 26545Species Escherichia coli [TaxId:562] [53463] (3 PDB entries)
  8. 26550Domain d1fwya2: 1fwy A:3-251 [34522]
    Other proteins in same PDB: d1fwya1, d1fwyb1

Details for d1fwya2

PDB Entry: 1fwy (more details), 2.3 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase bound to udp-glcnac

SCOP Domain Sequences for d1fwya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwya2 c.68.1.5 (A:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli}
nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
qaeklllag

SCOP Domain Coordinates for d1fwya2:

Click to download the PDB-style file with coordinates for d1fwya2.
(The format of our PDB-style files is described here.)

Timeline for d1fwya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwya1