SCOP 1.55: Domain d1fwyb1: 1fwy B:252-326

Lineage for d1fwyb1 (1fwy B:252-326)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies)

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families)

5. Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (1 species)

7. Species Escherichia coli [TaxId:562] [51173] (3 PDB entries)

8. Domain d1fwyb1: 1fwy B:252-326 [28065]
   Other proteins in same PDB: d1fwya2, d1fwyb2

Details for d1fwyb1

PDB Entry: 1fwy, 2.3 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase bound to udp-glcnac

SCOP Domain Sequences for d1fwyb1:

Sequence; same for both SEQRES and ATOM records:

>d1fwyb1 b.81.1.4 (B:252-326) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaacti

Timeline for d1fwyb1:

• d1fwyb1 appears in SCOP 1.57
  
• d1fwyb1 appears in the current release, SCOPe 2.08