| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
| Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
| Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries) |
| Domain d5b5em_: 5b5e M: [344154] Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ev_, d5b5ex_, d5b5ez_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b5e (more details), 1.87 Å
SCOPe Domain Sequences for d5b5em_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b5em_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d5b5em_: