![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [329405] (6 PDB entries) |
![]() | Domain d5b5ev_: 5b5e v: [329407] Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ex_, d5b5ez_ automated match to d1e29a_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b5e (more details), 1.87 Å
SCOPe Domain Sequences for d5b5ev_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b5ev_ a.3.1.0 (v:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d5b5ev_: