SCOPe 2.08: Domain d5b5ex_: 5b5e X:

Lineage for d5b5ex_ (5b5e X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries)

8. Domain d5b5ex_: 5b5e X: [329386]
   Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ev_, d5b5ez_
   automated match to d4il6x_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5ex_

PDB Entry: 5b5e, 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d5b5ex_:

Sequence; same for both SEQRES and ATOM records:

>d5b5ex_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

Timeline for d5b5ex_:

• d5b5ex_ first appeared in SCOPe 2.06
  
• d5b5ex_ appears in SCOPe 2.07