| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) ![]() |
| Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
| Protein automated matches [254444] (10 species) not a true protein |
| Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries) |
| Domain d3wmnd_: 3wmn D: [343890] Other proteins in same PDB: d3wmnc_, d3wmnh1, d3wmnh2, d3wmnm_ automated match to d3wmm1_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8 |
PDB Entry: 3wmn (more details), 3.01 Å
SCOPe Domain Sequences for d3wmnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmnd_ f.3.1.0 (D:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
nanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk
Timeline for d3wmnd_:
View in 3DDomains from other chains: (mouse over for more information) d3wmn0_, d3wmn1_, d3wmn2_, d3wmn3_, d3wmn4_, d3wmn5_, d3wmn6_, d3wmn7_, d3wmn8_, d3wmn9_, d3wmna_, d3wmnb_, d3wmnc_, d3wmne_, d3wmnf_, d3wmng_, d3wmnh1, d3wmnh2, d3wmni_, d3wmnj_, d3wmnk_, d3wmnm_, d3wmnn_, d3wmno_, d3wmnp_, d3wmnq_, d3wmnr_, d3wmns_, d3wmnt_, d3wmnu_, d3wmnv_, d3wmnw_, d3wmnx_, d3wmny_, d3wmnz_ |