Lineage for d3wmnh2 (3wmn H:44-259)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384684Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2384685Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2384686Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2384805Protein automated matches [226918] (3 species)
    not a true protein
  7. 2384819Species Thermochromatium tepidum [TaxId:1050] [267913] (4 PDB entries)
  8. 2384822Domain d3wmnh2: 3wmn H:44-259 [306769]
    Other proteins in same PDB: d3wmn0_, d3wmn1_, d3wmn2_, d3wmn3_, d3wmn4_, d3wmn5_, d3wmn6_, d3wmn7_, d3wmn8_, d3wmn9_, d3wmna_, d3wmnb_, d3wmnc_, d3wmnd_, d3wmne_, d3wmnf_, d3wmng_, d3wmnh1, d3wmni_, d3wmnj_, d3wmnk_, d3wmnm_, d3wmnn_, d3wmno_, d3wmnp_, d3wmnq_, d3wmnr_, d3wmns_, d3wmnt_, d3wmnu_, d3wmnv_, d3wmnw_, d3wmnx_, d3wmny_, d3wmnz_
    automated match to d3wmmh2
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmnh2

PDB Entry: 3wmn (more details), 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3wmnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmnh2 b.41.1.1 (H:44-259) automated matches {Thermochromatium tepidum [TaxId: 1050]}
drtersggrvkvvgfpdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpn
gdpmlsgfgpaaspdrpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgev
agtvsdvwvdrsepqirylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvp
tlsnpdqvtlyeedkvcayyaggklyataeragpll

SCOPe Domain Coordinates for d3wmnh2:

Click to download the PDB-style file with coordinates for d3wmnh2.
(The format of our PDB-style files is described here.)

Timeline for d3wmnh2: