Lineage for d3wmnn_ (3wmn N:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3021764Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)
  8. 3021911Domain d3wmnn_: 3wmn N: [306772]
    Other proteins in same PDB: d3wmnc_, d3wmnh1, d3wmnh2, d3wmnm_
    automated match to d1wrga_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmnn_

PDB Entry: 3wmn (more details), 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form
PDB Compounds: (N:) LH1 beta polypeptide

SCOPe Domain Sequences for d3wmnn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmnn_ f.3.1.0 (N:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
tgltddeakefhaifmqsmyawfglvviahllawlyrpwl

SCOPe Domain Coordinates for d3wmnn_:

Click to download the PDB-style file with coordinates for d3wmnn_.
(The format of our PDB-style files is described here.)

Timeline for d3wmnn_: