Lineage for d3wmnc_ (3wmn C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734274Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2734307Protein automated matches [227073] (3 species)
    not a true protein
  7. 2734313Species Thermochromatium tepidum [TaxId:1050] [267911] (5 PDB entries)
  8. 2734318Domain d3wmnc_: 3wmn C: [306765]
    Other proteins in same PDB: d3wmn0_, d3wmn1_, d3wmn2_, d3wmn3_, d3wmn4_, d3wmn5_, d3wmn6_, d3wmn7_, d3wmn8_, d3wmn9_, d3wmna_, d3wmnb_, d3wmnd_, d3wmne_, d3wmnf_, d3wmng_, d3wmnh1, d3wmnh2, d3wmni_, d3wmnj_, d3wmnk_, d3wmnm_, d3wmnn_, d3wmno_, d3wmnp_, d3wmnq_, d3wmnr_, d3wmns_, d3wmnt_, d3wmnu_, d3wmnv_, d3wmnw_, d3wmnx_, d3wmny_, d3wmnz_
    automated match to d3wmmc_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmnc_

PDB Entry: 3wmn (more details), 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3wmnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmnc_ a.138.1.2 (C:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy
qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra
ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp
fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf
ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk
plygaqmakdypglykt

SCOPe Domain Coordinates for d3wmnc_:

Click to download the PDB-style file with coordinates for d3wmnc_.
(The format of our PDB-style files is described here.)

Timeline for d3wmnc_: