SCOPe 2.08: Domain d5h7oa2: 5h7o A:246-437

Lineage for d5h7oa2 (5h7o A:246-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

8. Domain d5h7oa2: 5h7o A:246-437 [342837]
   Other proteins in same PDB: d5h7oa1, d5h7ob1, d5h7oc1, d5h7od1, d5h7oe_, d5h7of1, d5h7of2, d5h7of3
   automated match to d4i50a2
   complexed with 7q7, acp, ca, gdp, gol, gtp, mes, mg

Details for d5h7oa2

PDB Entry: 5h7o, 2.8 Å

PDB Description: crystal structure of dj-101 in complex with tubulin protein

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5h7oa2:

Sequence; same for both SEQRES and ATOM records:

>d5h7oa2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Timeline for d5h7oa2:

• d5h7oa2 first appeared in SCOPe 2.06
  
• d5h7oa2 appears in SCOPe 2.07