Lineage for d5h7od2 (5h7o D:244-431)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries)
  8. 2525703Domain d5h7od2: 5h7o D:244-431 [342736]
    Other proteins in same PDB: d5h7oa1, d5h7ob1, d5h7oc1, d5h7od1, d5h7oe_, d5h7of1, d5h7of2, d5h7of3
    automated match to d3rycd2
    complexed with 7q7, acp, ca, gdp, gol, gtp, mes, mg

Details for d5h7od2

PDB Entry: 5h7o (more details), 2.8 Å

PDB Description: crystal structure of dj-101 in complex with tubulin protein
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5h7od2:

Sequence, based on SEQRES records: (download)

>d5h7od2 d.79.2.1 (D:244-431) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5h7od2 d.79.2.1 (D:244-431) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5h7od2:

Click to download the PDB-style file with coordinates for d5h7od2.
(The format of our PDB-style files is described here.)

Timeline for d5h7od2: