Lineage for d5h7oa1 (5h7o A:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863851Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)
  8. 2864017Domain d5h7oa1: 5h7o A:1-245 [342836]
    Other proteins in same PDB: d5h7oa2, d5h7ob2, d5h7oc2, d5h7od2, d5h7oe_, d5h7of1, d5h7of2, d5h7of3
    automated match to d4ihja1
    complexed with 7q7, acp, ca, gdp, gol, gtp, mes, mg

Details for d5h7oa1

PDB Entry: 5h7o (more details), 2.8 Å

PDB Description: crystal structure of dj-101 in complex with tubulin protein
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5h7oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7oa1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5h7oa1:

Click to download the PDB-style file with coordinates for d5h7oa1.
(The format of our PDB-style files is described here.)

Timeline for d5h7oa1: