Lineage for d5h7oc2 (5h7o C:246-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959756Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)
  8. 2959923Domain d5h7oc2: 5h7o C:246-440 [342845]
    Other proteins in same PDB: d5h7oa1, d5h7ob1, d5h7oc1, d5h7od1, d5h7oe_, d5h7of1, d5h7of2, d5h7of3
    automated match to d4i50a2
    complexed with 7q7, acp, ca, gdp, gol, gtp, mes, mg

Details for d5h7oc2

PDB Entry: 5h7o (more details), 2.8 Å

PDB Description: crystal structure of dj-101 in complex with tubulin protein
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5h7oc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7oc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5h7oc2:

Click to download the PDB-style file with coordinates for d5h7oc2.
(The format of our PDB-style files is described here.)

Timeline for d5h7oc2: