Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [341366] (4 PDB entries) |
Domain d5vmgb_: 5vmg B: [341381] Other proteins in same PDB: d5vmga_, d5vmgc_, d5vmge_ automated match to d5bnyf_ complexed with bma, gal, nag, sia; mutant |
PDB Entry: 5vmg (more details), 2.45 Å
SCOPe Domain Sequences for d5vmgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vmgb_ h.3.1.0 (B:) automated matches {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]} glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse
Timeline for d5vmgb_: