Lineage for d5vmgd_ (5vmg D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646383Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [341366] (4 PDB entries)
  8. 2646391Domain d5vmgd_: 5vmg D: [341406]
    Other proteins in same PDB: d5vmga_, d5vmgc_, d5vmge_
    automated match to d5bnyf_
    complexed with bma, gal, nag, sia; mutant

Details for d5vmgd_

PDB Entry: 5vmg (more details), 2.45 Å

PDB Description: influenza hemagglutinin h1 mutant dh1e in complex with 6'sln
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d5vmgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmgd_ h.3.1.0 (D:) automated matches {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse

SCOPe Domain Coordinates for d5vmgd_:

Click to download the PDB-style file with coordinates for d5vmgd_.
(The format of our PDB-style files is described here.)

Timeline for d5vmgd_: