Lineage for d5bnyf_ (5bny F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646405Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (6 PDB entries)
  8. 2646409Domain d5bnyf_: 5bny F: [275813]
    Other proteins in same PDB: d5bnya_, d5bnyc_, d5bnye_
    automated match to d4d00d_
    complexed with nag

Details for d5bnyf_

PDB Entry: 5bny (more details), 2.66 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6)
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d5bnyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnyf_ h.3.1.0 (F:) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesv

SCOPe Domain Coordinates for d5bnyf_:

Click to download the PDB-style file with coordinates for d5bnyf_.
(The format of our PDB-style files is described here.)

Timeline for d5bnyf_: