Lineage for d1zoob_ (1zoo B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.62: Integrin A (or I) domain [53299] (1 superfamily) Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) 
Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins) 
Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53303] (6 PDB entries) 
Domain d1zoob_: 1zoo B: [34130]
Details for d1zoob_
PDB Entry: 1zoo (more details), 3 Å
PDB Description: cd11a i-domain with bound magnesium ion
SCOP Domain Sequences for d1zoob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoob_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens)}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vie
SCOP Domain Coordinates for d1zoob_:
Click to download the PDB-style file with coordinates for d1zoob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zoob_:
- d1zoob_ appears in SCOP 1.57
- d1zoob_ appears in the current release, SCOPe 2.08
View in 3D
