PDB entry 1zoo

View 1zoo on RCSB PDB site
Description: cd11a i-domain with bound magnesium ion
Deposited on 1996-06-21, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.279
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1zooa_
  • Chain 'B':
    Domains in SCOP 1.55: d1zoob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zooA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zooB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vie