SCOPe 2.04: Domain d1qb7a_: 1qb7 A:

Lineage for d1qb7a_ (1qb7 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Adenine PRTase [53288] (5 species)

7. Species Leishmania donovani [TaxId:5661] [53289] (4 PDB entries)

8. Domain d1qb7a_: 1qb7 A: [34087]
   complexed with ade, cit, mg

Details for d1qb7a_

PDB Entry: 1qb7, 1.5 Å

PDB Description: crystal structures of adenine phosphoribosyltransferase from leishmania donovani.

PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d1qb7a_:

Sequence; same for both SEQRES and ATOM records:

>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]}
pfkevspnsfllddshalsqllkksyrwyspvfsprnvprfadvssitespetlkairdf
lvqryramspapthilgfdargflfgpmiaveleipfvlmrkadknagllirsepyekey
keaapevmtirygsigkgsrvvliddvlatggtalsglqlveasdavvvemvsilsipfl
kaaekihstansrykdikfisllsddalteencgdsknytgprvlscgdvlaehph

Timeline for d1qb7a_:

• d1qb7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qb7a_ appears in SCOPe 2.03
  
• d1qb7a_ appears in SCOPe 2.05
  
• d1qb7a_ appears in the current release, SCOPe 2.08