![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Adenine PRTase [53288] (5 species) |
![]() | Species Leishmania donovani [TaxId:5661] [53289] (4 PDB entries) |
![]() | Domain d1qb7a_: 1qb7 A: [34087] complexed with ade, cit, mg |
PDB Entry: 1qb7 (more details), 1.5 Å
SCOPe Domain Sequences for d1qb7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} pfkevspnsfllddshalsqllkksyrwyspvfsprnvprfadvssitespetlkairdf lvqryramspapthilgfdargflfgpmiaveleipfvlmrkadknagllirsepyekey keaapevmtirygsigkgsrvvliddvlatggtalsglqlveasdavvvemvsilsipfl kaaekihstansrykdikfisllsddalteencgdsknytgprvlscgdvlaehph
Timeline for d1qb7a_: