Lineage for d1qb7a_ (1qb7 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily) Superfamily c.61.1: PRTase-like [53271] (2 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins) 
Protein Adenine PRTase [53288] (1 species) Species Leishmania donovani [TaxId:5661] [53289] (4 PDB entries) 
Domain d1qb7a_: 1qb7 A: [34087]
Details for d1qb7a_
PDB Entry: 1qb7 (more details), 1.5 Å
PDB Description: crystal structures of adenine phosphoribosyltransferase from leishmania donovani.
SCOP Domain Sequences for d1qb7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani}
pfkevspnsfllddshalsqllkksyrwyspvfsprnvprfadvssitespetlkairdf
lvqryramspapthilgfdargflfgpmiaveleipfvlmrkadknagllirsepyekey
keaapevmtirygsigkgsrvvliddvlatggtalsglqlveasdavvvemvsilsipfl
kaaekihstansrykdikfisllsddalteencgdsknytgprvlscgdvlaehph
SCOP Domain Coordinates for d1qb7a_:
Click to download the PDB-style file with coordinates for d1qb7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qb7a_:
- d1qb7a_ appears in SCOP 1.57
- d1qb7a_ appears in the current release, SCOPe 2.08
View in 3D