PDB entry 1qb7

View 1qb7 on RCSB PDB site
Description: crystal structures of adenine phosphoribosyltransferase from leishmania donovani.
Class: transferase
Keywords: dinucleotide binding fold, transferase
Deposited on 1999-04-30, released 1999-07-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Leishmania donovani [TaxId:5661]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qb7a_
  • Heterogens: MG, ADE, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qb7A (A:)
pfkevspnsfllddshalsqllkksyrwyspvfsprnvprfadvssitespetlkairdf
lvqryramspapthilgfdargflfgpmiaveleipfvlmrkadknagllirsepyekey
keaapevmtirygsigkgsrvvliddvlatggtalsglqlveasdavvvemvsilsipfl
kaaekihstansrykdikfisllsddalteencgdsknytgprvlscgdvlaehph