SCOP 1.63: Domain d1tipb_: 1tip B:

Lineage for d1tipb_ (1tip B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
   bifunctional enzyme

7. Species Rat (Rattus norvegicus) [TaxId:10116] [53269] (5 PDB entries)

8. Domain d1tipb_: 1tip B: [34007]
   complexed with f6p, h2p; mutant

Details for d1tipb_

PDB Entry: 1tip, 2.2 Å

PDB Description: the bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase

SCOP Domain Sequences for d1tipb_:

Sequence; same for both SEQRES and ATOM records:

>d1tipb_ c.60.1.4 (B:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)}
mrsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
gcrvesiylnv

Timeline for d1tipb_:

• d1tipb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tipb_ appears in SCOP 1.61
  
• d1tipb_ appears in SCOP 1.65
  
• d1tipb_ appears in the current release, SCOPe 2.08