Lineage for d1tipb_ (1tip B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25777Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 25778Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 25834Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)
  6. 25835Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (1 species)
  7. 25836Species Rat (Rattus norvegicus) [TaxId:10116] [53269] (5 PDB entries)
  8. 25841Domain d1tipb_: 1tip B: [34007]

Details for d1tipb_

PDB Entry: 1tip (more details), 2.2 Å

PDB Description: the bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase

SCOP Domain Sequences for d1tipb_:

Sequence, based on SEQRES records: (download)

>d1tipb_ c.60.1.4 (B:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)}
mrsiylcrxgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
gcrvesiylnv

Sequence, based on observed residues (ATOM records): (download)

>d1tipb_ c.60.1.4 (B:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)}
mrsiylcrgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrtiq
taealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyedl
vqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvayg
crvesiylnv

SCOP Domain Coordinates for d1tipb_:

Click to download the PDB-style file with coordinates for d1tipb_.
(The format of our PDB-style files is described here.)

Timeline for d1tipb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tipa_